PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.J01573.1.p
Common NameEUGRSUZ_J01573, LOC104423714
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 208aa    MW: 24388.7 Da    PI: 9.738
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.J01573.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.79.6e-171158148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd ll   v+++G g W++++++ g++R++k+c++rw++yl
  Eucgr.J01573.1.p 11 KGSWTEEEDVLLRSSVQRYGEGEWHRVPQRAGLNRCRKSCRLRWLNYL 58
                      799*******************************************97 PP

2Myb_DNA-binding46.96.3e-1564109148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg++  +E + +++++k+lG++ W++Ia +++ gRt++++k++w+++l
  Eucgr.J01573.1.p  64 RGKFQDDEVDMIIRLHKLLGNR-WSLIAGRLP-GRTANDVKNYWNTHL 109
                       8999******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.229658IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-21860IPR009057Homeodomain-like
SuperFamilySSF466891.24E-278105IPR009057Homeodomain-like
SMARTSM007174.7E-141060IPR001005SANT/Myb domain
PfamPF002495.5E-161158IPR001005SANT/Myb domain
CDDcd001671.98E-91358No hitNo description
PROSITE profilePS5129424.21659113IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.2E-2461112IPR009057Homeodomain-like
SMARTSM007173.1E-1463111IPR001005SANT/Myb domain
PfamPF002491.6E-1364109IPR001005SANT/Myb domain
CDDcd001675.43E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MQKGSSFGLR KGSWTEEEDV LLRSSVQRYG EGEWHRVPQR AGLNRCRKSC RLRWLNYLKP  60
NIKRGKFQDD EVDMIIRLHK LLGNRWSLIA GRLPGRTAND VKNYWNTHLR KLMTCQGKPE  120
NEKPQDLVKV EVIRPRPRTI SKNFSSLGVE AYRELNESRE PRVHDVPPNR SPWIDDDFQL  180
RSETTEAWLD CWSGLSFDAE SIWDWPV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-22211118126MYB TRANSFORMING PROTEIN
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.J01573.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM7730235e-93HM773023.1 Syzygium malaccense MYB transcription factor (MYB) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010034473.11e-152PREDICTED: transcription factor MYB114-like
SwissprotQ9FNV93e-63MY113_ARATH; Transcription factor MYB113
TrEMBLA0A059ADG71e-152A0A059ADG7_EUCGR; Uncharacterized protein
STRINGVIT_14s0006g01290.t018e-68(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.12e-64myb domain protein 113